PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI01G11230.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family Dof
Protein Properties Length: 555aa    MW: 60282.1 Da    PI: 4.7165
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI01G11230.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof126.29.8e-40168227261
           zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                      ++k+l+cprC+s++tkfCyynny+++qPr+fCk+C+ryWt+GG++rnvPvG+grrk+k+s
  ORUFI01G11230.1 168 PDKILPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGTMRNVPVGAGRRKSKSS 227
                      7899*****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-31165225IPR003851Zinc finger, Dof-type
PfamPF027013.3E-32170226IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.863172226IPR003851Zinc finger, Dof-type
PROSITE patternPS013610174210IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 555 aa     Download sequence    Send to blast
MCDKDPGIKL FGRVIPLAPE AEAAAAADGS DQPEAAAAAA AAAAAEVEPA AQDEDHHKET  60
EERKYDEMKV DVPQEEEDNE MKVDAPQEKK DNEVTADVPE EKGNDEMRVD ASESIESIEP  120
VSRSTLDNKK EDQGQMNNVE EKAASDSKDE NEKTANDESG QDKVLKKPDK ILPCPRCNSM  180
DTKFCYYNNY NVNQPRHFCK NCQRYWTAGG TMRNVPVGAG RRKSKSSSLH YRHLLMAPDC  240
MMGSRVEISK SMNPEAFASA HSTPIQPIGR NETVLKFGPE VPLCESMASV LNIQEQNGTN  300
AAAVPTGENQ EDNSCISSIT SHNVLPENAA QVDKNSTPVY CNGVGPVPQY YLGAPYMYPW  360
NIGWNNVPMM VPGTSMPESA SQSESCSTSS APWMNMNSPM MPVASRLSAP PFPYPLVPPA  420
LWGCLSSWPA MAWNIPWIRT NGGCMSPSSS SNSSCSGNGS PLGKHSRDSS LPLKEDKEEK  480
SLWVPKTLRI DDPDEAAKSS IWATLGIKPG DPGIFKPFQS KGESKGQAAS ETRPARALKA  540
NPAALSRSQS FQETS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0013830.0AP001383.1 Oryza sativa Japonica Group genomic DNA, chromosome 1, clone:P0453A06.
GenBankAP0149570.0AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015618265.10.0PREDICTED: cyclic dof factor 2
TrEMBLA0A0E0MUA20.0A0A0E0MUA2_ORYRU; Uncharacterized protein
STRINGLOC_Os01g15900.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP143438116
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.27e-70cycling DOF factor 2